Gene XP_010919018.1


Sequence ID XP_010919018.1  add to my list
Species Elaeis guineensis
Alias No gene alias
Length 125aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 125 amino acids

>XP_010919018.1_ELAGV
MAGLQIVPADKRVEAQYVEMKVPLYSYGCEKKIKKALSHMRGIHSVHVDYHLQKVTVWGI
CNQDDVLATIRKKRREARFWDQMETEVKNKVAEEEADAGNAPDPATVNTHKFRKSWKKLF
PLVLY




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP342521 Unannotated cluster
4 GP077751 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for XP_010919018.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU2Hr1G093870.1 orthology 0.829 7 149.4 1.7e-36
Mba04_g24060.1 orthology 0.417 4 - -
Sspon.05G0023740-1B orthology 0.609 5 - -
Sspon.05G0023740-1P orthology 0.609 6 - -
Sspon.05G0023740-2D orthology 0.609 6 161.8 8.9e-40
XP_008808278.1 orthology 0.106 2 228.8 3.1e-60
bradi_pan_p042306 orthology 0.857 6 - -
cocnu_pan_p024529 orthology 0.116 1 231 7.99e-80
maize_pan_p011588 orthology 0.695 4 149 1.75e-47
musac_pan_p009117 orthology 0.433 4 - -
orysa_pan_p048607 orthology 0.787 5 - -
orysa_pan_p051674 orthology 1 5 - -
sorbi_pan_p001968 orthology 0.625 5 161 1.24e-52
tritu_pan_p012747 orthology 0.83 7 - -
tritu_pan_p017403 orthology 0.839 7 - -
tritu_pan_p047012 orthology 0.822 7 - -