Gene XP_010922268.1
| Sequence ID | XP_010922268.1 add to my list | ||
|---|---|---|---|
| Species | Elaeis guineensis | ||
| Alias | No gene alias | ||
| Length | 252aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 252 amino acids
>XP_010922268.1_ELAGV MVPELEKARVTELHVRMDCNGCVQKIKKAMHGIDGVYDVYVDSAKQKLTIVGRADPEKIV KAIKKTGKIATICSHTEQVEASGSEQPPSTEAAASSSPPATEPADQPPSEAPPTPPAEPP QEAPFGETKAPEINPSPEAQDATPTESKDVEEIHMVHRYPHSYIYREHWNHYPTSGHEIR HEASSHVAHSYSSYRPSPYVTGYGHLQSAPQDIRYGGAEALHDGYYHNQGGGDGNQITSI FSDENPNACRIV
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP047778 | Unannotated cluster |
| 4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_010922268.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba02_g01150.1 | orthology | 0.476 | 4 | 193.7 | 1.5e-49 |
| XP_008795807.1 | orthology | 0.102 | 2 | 365.5 | 4.3e-101 |
| cocnu_pan_p004474 | orthology | 0.0956 | 1 | 426 | 4.94e-153 |
| musac_pan_p043456 | orthology | 0.495 | 4 | 214 | 6.55e-70 |