Gene XP_010931631.1
| Sequence ID | XP_010931631.1 add to my list | ||
|---|---|---|---|
| Species | Elaeis guineensis | ||
| Alias | No gene alias | ||
| Length | 295aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 295 amino acids
>XP_010931631.1_ELAGV MASPEEGPEPLKYQTLTLKVSIHCEGCKKKVKKVLHSIEGVYKTTVDSQQQKVIVIGNVE ADTLIKKLLKTGKHAELWPEKKPNNPGGGGGGGGKKNKNKNKASGKPNEPSENPESNQTP SGDDSPPDSSANADGNAPNIGGKDSPKADNKETGNSPPSDKQNGGGGGAPAPAPGGGGGG GKKKGKKGQKENSGGGGGGGGGGGGEGPGVSEGMGGKPGSGGGSVVSLPAFSYGVYPTSQ PPAYVVSYSTVQPSASYGGAYYPMPMNQSSYFYSTATPGSCYIFSDENANACRIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_010931631.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba02_g04300.1 | orthology | 0.617 | 3 | 179 | 5.31e-55 |
| Mba09_g27230.1 | orthology | 0.657 | 3 | - | - |
| Mba11_g12300.1 | orthology | 0.579 | 3 | - | - |
| cocnu_pan_p006778 | orthology | 0.0708 | 1 | 382 | 2.81e-133 |
| musac_pan_p013541 | orthology | 0.649 | 3 | 184 | 9.94e-57 |
| musac_pan_p014845 | orthology | 0.978 | 3 | - | - |
| musac_pan_p029076 | orthology | 0.602 | 3 | - | - |
| musac_pan_p032387 | orthology | 0.566 | 2 | - | - |