Gene XP_010932092.1
| Sequence ID | XP_010932092.1 add to my list | ||
|---|---|---|---|
| Species | Elaeis guineensis | ||
| Alias | No gene alias | ||
| Length | 88aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 88 amino acids
>XP_010932092.1_ELAGV METIELKVEMVALHEKRLRKCLSKVKGIEKVEVEASIQKVVVTGYAHRNKILKALRRVGL RAEFWSPQNEILSAYASGSLMINNFSFF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_010932092.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_12_32.9 | orthology | 0.457 | 8 | - | - |
| Ca_3_262.11 | orthology | 0.457 | 8 | - | - |
| Ca_455_136.3 | orthology | 0.457 | 8 | - | - |
| Ca_68_16.11 | orthology | 0.48 | 8 | 119 | 4e-27 |
| Cc10_g00290 | orthology | 0.48 | 8 | 105.1 | 2e-23 |
| Cg3g025710.1 | orthology | 0.351 | 10 | 134 | 4.2e-32 |
| Cm122260.1 | orthology | 0.363 | 9 | 131 | 6e-31 |
| Cs3g27690.1 | orthology | 0.351 | 10 | 134 | 4.6e-32 |
| DCAR_023025 | orthology | 0.341 | 5 | 126.3 | 1e-29 |
| HORVU7Hr1G051110.3 | orthology | 0.6 | 6 | 102.1 | 2.2e-22 |
| MELO3C017056.2.1 | orthology | 0.497 | 10 | - | - |
| Manes.05G127500.1 | orthology | 0.39 | 8 | - | - |
| Manes.18G002200.1 | orthology | 0.403 | 8 | 125.9 | 1.4e-29 |
| Mba08_g25790.1 | orthology | 0.223 | 4 | 144.4 | 3.7e-35 |
| ORGLA08G0178600.1 | orthology | 0.32 | 5 | 132.1 | 1.8e-31 |
| Oeu013567.1 | orthology | 0.361 | 6 | 122.9 | 1.6e-28 |
| Sspon.06G0001840-1A | orthology | 0.528 | 4 | - | - |
| Sspon.06G0001840-2C | orthology | 0.34 | 4 | - | - |
| Sspon.06G0001840-3D | orthology | 0.35 | 4 | 129 | 4.5e-30 |
| bradi_pan_p007471 | orthology | 0.331 | 5 | 136 | 1.3e-43 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_11445.1 | orthology | 0.506 | 6 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 | orthology | 0.504 | 6 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22894.1 | orthology | 0.502 | 5 | 124.4 | 4e-29 |
| capan_pan_p037558 | orthology | 0.468 | 7 | 109 | 4.55e-33 |
| cicar_pan_p012771 | orthology | 0.624 | 7 | 124 | 4.88e-39 |
| cocnu_pan_p024788 | orthology | 0.0011 | 1 | 164 | 1.04e-54 |
| cucsa_pan_p017207 | orthology | 0.497 | 10 | - | - |
| maize_pan_p023740 | orthology | 0.323 | 4 | 125 | 1.75e-39 |
| maldo_pan_p020708 | orthology | 0.387 | 8 | 125 | 3.43e-39 |
| medtr_pan_p031498 | orthology | 0.556 | 7 | 126 | 1.18e-39 |
| musac_pan_p036492 | orthology | 0.211 | 4 | 145 | 1.82e-47 |
| orysa_pan_p046260 | orthology | 0.296 | 5 | 135 | 4.77e-43 |
| phavu.G19833.gnm2.ann1.Phvul.002G208500.1 | orthology | 0.513 | 5 | 124 | 4.7e-29 |
| sorbi_pan_p020199 | orthology | 0.298 | 4 | 131 | 1.05e-41 |
| soybn_pan_p018879 | orthology | 0.556 | 5 | 121 | 9.46e-38 |
| soybn_pan_p037728 | orthology | 0.581 | 6 | - | - |
| soybn_pan_p037999 | orthology | 0.623 | 6 | - | - |
| soybn_pan_p041984 | orthology | 0.591 | 6 | - | - |
| thecc_pan_p004256 | orthology | 0.399 | 9 | 115 | 1.38e-35 |
| tritu_pan_p008810 | orthology | 0.336 | 6 | 130 | 3.75e-41 |
| vitvi_pan_p014910 | orthology | 0.313 | 7 | 134 | 1.05e-42 |
| vitvi_pan_p031077 | orthology | 0.313 | 7 | - | - |