GreenPhyl v5 - Gene XP

Gene XP_010933357.1

Sequence ID

XP_010933357.1 ^{add to my list}

Species

Elaeis guineensis

Alias

No gene alias

Length

154aa

Gene Ontology

biological_process	metal ion transport GO:0030001 - metal ion transport

Gene Sequence
Gene Classification
Domain Pattern
Homolog Predictions

154 amino acids

>XP_010933357.1_ELAGV
MGVLDYVSELCSLPKDQRKLRKKQFQTVEMKVRIDCEGCERKVKKALEEIKGVSSVEIER
KQNKVTVTGYVDGKKVIKRVRRRTGKMVEPWPYVPYDMVPHPYAPGAYDRKAPPGYVRNV
MDDPKLAQLVRASSMEERYSSAFSDDNPNSCAIM

Clustering Level	Family ID	Family Name
1	Heavy metal transport/detoxification protein superfamily GP000323	Heavy metal transport/detoxification protein superfamily
2	Heavy metal transport/detoxification group1 GP015397	Heavy metal transport/detoxification group1
3	GP040065	Unannotated cluster
4	GP463617	Unannotated cluster

This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.

ID	Name	Type
Heavy metal-associated domain, HMA IPR006121	Heavy metal-associated domain, HMA	Domain
Heavy metal-associated domain superfamily IPR036163	Heavy metal-associated domain superfamily	Homologous_superfamily

IPR006121 IPR036163

IPR domains for XP_010933357.1

	Homology			RBH
Similar Sequence ID	Type	Evolutionary distance	Node distance	score	e-value
ORGLA03G0040300.1	orthology	0.507	4	-	-
Sspon.01G0050820-1C	orthology	0.531	5	-	-
Sspon.01G0050820-2D	orthology	0.524	5	-	-
XP_008809430.1	orthology	0.0882	2	287.3	9.1e-78
cocnu_pan_p018212	orthology	0.0552	1	293	1.14e-103
cocnu_pan_p033502	orthology	0.0676	1	-	-
maize_pan_p031380	orthology	0.551	5	-	-
orysa_pan_p027349	orthology	0.507	4	-	-
sorbi_pan_p009526	orthology	0.509	4	-	-