Gene XP_010934032.1


Sequence ID XP_010934032.1  add to my list
Species Elaeis guineensis
Alias No gene alias
Length 125aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 125 amino acids

>XP_010934032.1_ELAGV
MADLQIVPAGKHVEAQYVEMKVPLYSYGCEKKIKKALSHLRGIHSVHVDYQLQKVTVWGI
CNKYDVLATIRKKRREARFWDQMETEVKSKVAEEEADAEKAPRRATISMRKFRKSWKKLL
PLVLY




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP342521 Unannotated cluster
4 GP077751 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for XP_010934032.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU2Hr1G093870.1 orthology 0.787 6 - -
Mba04_g24060.1 orthology 0.376 3 180.3 8.6e-46
Sspon.05G0023740-1B orthology 0.567 4 - -
Sspon.05G0023740-1P orthology 0.567 5 - -
Sspon.05G0023740-2D orthology 0.567 5 - -
bradi_pan_p042306 orthology 0.815 5 143 4.09e-45
cocnu_pan_p020678 orthology 0.0312 1 239 1.46e-83
maize_pan_p011588 orthology 0.653 3 - -
musac_pan_p009117 orthology 0.391 3 177 7.37e-59
orysa_pan_p048607 orthology 0.746 4 150 3.04e-48
orysa_pan_p051674 orthology 1 4 - -
sorbi_pan_p001968 orthology 0.583 4 - -
tritu_pan_p012747 orthology 0.788 6 143 2.76e-45
tritu_pan_p017403 orthology 0.797 6 - -
tritu_pan_p047012 orthology 0.78 6 - -