Gene XP_010934034.1
Sequence ID | XP_010934034.1 add to my list | ||
---|---|---|---|
Species | Elaeis guineensis | ||
Alias | No gene alias | ||
Length | 336aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 336 amino acids
>XP_010934034.1_ELAGV MGEAKQEEAKVEAKLEEKKEEKKEEKQEEEEEEKEEKKEEAKPSPPPPIILFVDLHCFGC AKKIEKCVLKCRGVEGVETDMVQNQLTIKGMVDPQALCSRIQKKTLKRARVLSPLPPAEG ESKQEQVVPSQVSGVTTVEIHVNMHCEACAQQLRRKILKMRGVQTAETELSTGKVMVTGT MNGEKLTDYIHRRTGKLATIVPQPPKEEEKKEEAEKKAEEKPPEEKKEEKAEEKKEEKAE EKKEESAEGNKDGGGKEEKGGGEEQKKEGEGPTNVDIPNGADMVMKRMVYWNGNIISEEE MARRMMMHWMPVYVIERPPPPPQIFSDENPNACCIS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP126431 | Unannotated cluster |
4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_010934034.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba04_g24040.1 | orthology | 0.437 | 4 | 229.6 | 3.3e-60 |
Mba05_g07700.1 | orthology | 0.434 | 4 | - | - |
Mba05_g22300.1 | orthology | 0.383 | 4 | 263 | 3.47e-86 |
XP_008783550.1 | orthology | 0.0707 | 2 | 302 | 7.8e-82 |
cocnu_pan_p019921 | orthology | 0.0701 | 1 | 407 | 5.12e-143 |
musac_pan_p012393 | orthology | 0.311 | 4 | 300 | 4.34e-101 |
musac_pan_p028148 | orthology | 0.38 | 4 | - | - |
musac_pan_p044150 | orthology | 0.617 | 4 | - | - |