Gene XP_010939612.1
| Sequence ID | XP_010939612.1 add to my list | ||
|---|---|---|---|
| Species | Elaeis guineensis | ||
| Alias | No gene alias | ||
| Length | 149aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 149 amino acids
>XP_010939612.1_ELAGV MGGALEYFAGLLAGSRRRKKRKQFQTVELKVRMDCEGCERKVKKALSSMKGVQSVDVNRK QNKVTVTGYVEQHKVLKKARSTGKKAEIWPYIPYNLVMHPYAAQAYDKKAPPGYVRNVEA ITISSQPYRQEDQLTNLFSDENPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_010939612.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| XP_008790801.1 | orthology | 0.141 | 2 | 276.9 | 1.2e-74 |
| cocnu_pan_p021385 | orthology | 0.108 | 1 | 281 | 2.95e-99 |
| cocnu_pan_p030765 | orthology | 0.108 | 1 | - | - |