Gene XP_010940635.1
| Sequence ID | XP_010940635.1 add to my list | ||
|---|---|---|---|
| Species | Elaeis guineensis | ||
| Alias | No gene alias | ||
| Length | 193aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 193 amino acids
>XP_010940635.1_ELAGV MGNQEKKNGGEREKKDDRTITVVLKVGMYCEGCAKEVKKSVEGFEGVEQVKVDIGAGMLR VVGKVDPSRLRDHVAKKTNRKVDLVSPTNNPQKDAKKKDDPKKPTAGKDSNKSDKKKSKE PGLLTVVLKTHLHCDCYAKLIKKKILKHEGVRLVVADVQKGMIMVTGTMDVKRVLKMLKQ ELEQTVEVAAVGS
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP239638 | Unannotated cluster |
| 3 | GP341755 | Unannotated cluster |
| 4 | GP503382 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_010940635.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba01_g27600.1 | orthology | 0.934 | 1 | - | - |
| Mba01_g27610.1 | orthology | 1 | 2 | - | - |
| XP_010940636.1 | ultra-paralogy | 0.0011 | 0 | - | - |
| XP_010940637.1 | ultra-paralogy | 0.225 | 0 | - | - |
| XP_010940638.1 | ultra-paralogy | 0.223 | 0 | - | - |
| XP_019710924.1 | ultra-paralogy | 0.279 | 0 | - | - |
| musac_pan_p011710 | orthology | 0.962 | 2 | - | - |