Gene XP_019703519.1
Sequence ID | XP_019703519.1 add to my list | ||
---|---|---|---|
Species | Elaeis guineensis | ||
Alias | No gene alias | ||
Length | 333aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 333 amino acids
>XP_019703519.1_ELAGV MGEEGKKEEKPKEKEEKREEAKAEEGKKGGGGGGGGNGEKEGGGQEEKKGEETPPPSPPE EIVMRVYMHCEGCSRKVKRCLQGFEGVEEVKTDCRSHKVVVKGKKAAEDPLKVVERIQKK TGRKVELLTPLPPPKPEKKEEEKKEEEKPKPEEKKEEPPVIAVVLKVHMHCEACSQEIKK RILKMKGVQAAEPDLKASQVTVTGVLDPPKLVEYVYKRTGKHAAVVKQEPVEKKPDEEKK AADGKDGSKDEKKADAGGEKAEGEKKDEKEGGGEEKEKEAGGGAGDHAAAGGAAKMVDLM KNEFYYYYPRYGVGYAYPPQIFSDENPNACTVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_019703519.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba06_g07140.1 | orthology | 0.226 | 4 | 268 | 3.66e-88 |
Mba09_g01180.1 | orthology | 0.313 | 4 | - | - |
XP_008798969.1 | orthology | 0.0732 | 2 | 310 | 8.17e-105 |
XP_010913005.1 | ultra-paralogy | 0.001 | 0 | - | - |
cocnu_pan_p032228 | orthology | 0.0622 | 1 | - | - |
cocnu_pan_p033823 | orthology | 0.0401 | 1 | 293 | 2.38e-98 |
musac_pan_p001323 | orthology | 0.254 | 4 | - | - |
musac_pan_p006095 | orthology | 0.229 | 4 | 266 | 1.04e-87 |
musac_pan_p033691 | orthology | 0.524 | 3 | - | - |