Gene XP_026665746.1
| Sequence ID | XP_026665746.1 add to my list |
|---|---|
| Species | Phoenix dactylifera |
| Alias | No gene alias |
| Length | 78aa |
Length: 78 amino acids
>XP_026665746.1_PHODC MAAKYIGAAVASFAIVYVVDTAIAEKKIFGGTTPKTVADKEWWKATDQKFQAWPRTAGPP VVMNPISRQNFIVKFHEA
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for XP_026665746.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba01_g28000.1 | orthology | 0.44 | 3 | - | - |
| Mba02_g06510.1 | orthology | 1 | 3 | - | - |
| Mba07_g04570.1 | orthology | 0.615 | 3 | - | - |
| XP_026665744.1 | orthology | 0 | 1 | - | - |
| XP_026665745.1 | orthology | 0 | 1 | - | - |
| musac_pan_p013029 | orthology | 0.44 | 3 | - | - |
| musac_pan_p019196 | orthology | 0.518 | 3 | - | - |
| musac_pan_p041148 | orthology | 0.865 | 3 | - | - |
| musac_pan_p043143 | orthology | 0.6 | 3 | - | - |