Gene brana_pan_p008102
Sequence ID | brana_pan_p008102 add to my list | ||
---|---|---|---|
Species | Brassica napus | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 284aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 284 amino acids
>brana_pan_p008102_BRANA MEKKAEEPQVKKTDDKKEEEKKKEPQEIVLKIFMHCEGCAKKIHRCLKGFEGVEDVTTDC KTSKVVVKGEKADPLKVLQRLQRKSHRPVELLSPIPEPKPVSDEPEKKEEKPKPQEKKEE VVTVVLRVHMHCEACAMEIQKRIMRMKGVESVEPDFKASQVSVKGVFTPEKLVEYVNKKI GKHAAIVKQDPSLKPPEKEKETKDKDEKKKEEEQPKESKEAKEDGGGVAKSAAGDGGAAA EGGDKVVDIKKNEYQYQPPRYPVEMFAYPPQIFSDENPNACTMM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p008102
Represented sequence(s):
BRANA_Tapidor_v6.3
BRANA_v5.0
BRANA_Darmor_v8.1
1. | 2. | 3. | 4. | 5. | 6. | |
---|---|---|---|---|---|---|
1. BnaA03g15340.1D2 | 0.00 | 2.03 | 5.85 | 4.35 | 2.14 | -0.00 |
2. BnaC03g16140.1D2 | 2.03 | 0.00 | 2.88 | 4.35 | -0.00 | 2.14 |
3. BnaA03g15300.1T | 5.85 | 2.88 | 0.00 | 1.43 | 2.88 | 5.85 |
4. BnaC02g03940.1T | 4.35 | 4.35 | 1.43 | 0.00 | 4.35 | 4.35 |
5. GSBRNA2T00082763001 | 2.14 | -0.00 | 2.88 | 4.35 | 0.00 | 2.14 |
6. GSBRNA2T00142198001 | -0.00 | 2.14 | 5.85 | 4.35 | 2.14 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT5G50740.3 | orthology | 0.0993 | 3 | 320 | 2.69e-110 |
MELO3C002372.2.1 | orthology | 0.466 | 5 | 261 | 1.98e-86 |
braol_pan_p032028 | orthology | 0.001 | 1 | 402 | 2.5e-142 |
brarr_pan_p007939 | orthology | 0.0282 | 2 | 358 | 7.07e-126 |
cucsa_pan_p017723 | orthology | 0.468 | 5 | 262 | 4.64e-87 |