Gene brana_pan_p021690
| Sequence ID | brana_pan_p021690 add to my list |
|---|---|
| Species | Brassica napus |
| Alias | No gene alias |
| Pangenome status | Dispensable (2/3) |
| Length | 79aa |
Length: 79 amino acids
>brana_pan_p021690_BRANA MFGTDRYRREIGGGKKAEFWPYIPQHMVYYPFDTGMYDKRAPAGHIRNPTQAFPAANTPG ENYVSLFSDDNVQAACSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
Unrepresented genome(s):
BRANA_Darmor_v8.1
BRANA_Tapidor_v6.3
BRANA_v5.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| musac_pan_p027847 | orthology | 1 | 1 | - | - |