Gene brana_pan_p026080
Sequence ID | brana_pan_p026080 add to my list |
---|---|
Species | Brassica napus |
Alias | No gene alias |
Pangenome status | Dispensable (2/3) |
Length | 68aa |
Length: 68 amino acids
>brana_pan_p026080_BRANA MSRGKYIVGALVGSAVVAYVCSTPGTITNKAWGAATEERLQAWPRTAGPPVVMNPISRQN FIVKSRPE
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for brana_pan_p026080
Represented sequence(s):
Unrepresented genome(s):
BRANA_Tapidor_v6.3
BRANA_Darmor_v8.1
BRANA_v5.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT4G00860.1 | orthology | 0.17 | 1 | - | - |
FvH4_3g28670.1 | orthology | 0.751 | 4 | - | - |
FvH4_5g27260.1 | orthology | 0.876 | 4 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_09476.1 | orthology | 1 | 6 | - | - |
cicar_pan_p021438 | orthology | 1 | 4 | - | - |
cicar_pan_p021882 | orthology | 1 | 4 | - | - |
maldo_pan_p050830 | orthology | 0.734 | 4 | - | - |
medtr_pan_p001744 | orthology | 1 | 5 | - | - |
medtr_pan_p009141 | orthology | 1 | 5 | - | - |
phavu.G19833.gnm2.ann1.Phvul.001G134700.2 | orthology | 1 | 7 | - | - |
soybn_pan_p000766 | orthology | 1 | 7 | - | - |
soybn_pan_p008913 | orthology | 1 | 7 | - | - |
soybn_pan_p014436 | orthology | 1 | 7 | - | - |
soybn_pan_p035092 | orthology | 1 | 7 | - | - |