Gene brana_pan_p035164
| Sequence ID | brana_pan_p035164 add to my list | ||
|---|---|---|---|
| Species | Brassica napus | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 77aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 77 amino acids
>brana_pan_p035164_BRANA MTNVVEMKVNLHCDECIRKILKAIKKIEDIETYDVDTQLNKVTVTGNVTDEQVIKVLQKV RKTAVKWDQANQTLFPN
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP240412 | Unannotated cluster |
| 3 | GP342479 | Unannotated cluster |
| 4 | GP464531 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p035164
Represented sequence(s):
BRANA_Tapidor_v6.3
BRANA_v5.0
BRANA_Darmor_v8.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT5G05365.1 | orthology | 0.15 | 2 | 140 | 6.25e-46 |
| Cg7g002740.2 | orthology | 0.457 | 5 | 115 | 7.05e-36 |
| Cm077550.1 | orthology | 0.41 | 5 | 119 | 3.54e-37 |
| Cs7g30320.1 | orthology | 0.409 | 4 | 119 | 1.61e-37 |
| brarr_pan_p011926 | orthology | 0.0162 | 1 | 154 | 6.4e-51 |