Gene brana_pan_p036701
| Sequence ID | brana_pan_p036701 add to my list | ||
|---|---|---|---|
| Species | Brassica napus | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 267aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 267 amino acids
>brana_pan_p036701_BRANA MKGRMFCASQASTAICSSMDHIPKPTTTTFVVDDEKLSDRAIDRHNPIIKDGRRSSVDDY IRIPASPADGEISNKTLEIYKGRRSVTARKSTGGGGSGGGAAALLKLITNDLSFARKSFS CVARPSSDFVKTPAGSTRYLLGSEPVSLTGSAGQDTVAPKSPAVEEIKPSMEEKTSGGGG GADQVVVLKVSLHCRGCEAKVRKHLSRMQGVTSFNIDFAAKKVTVTGDITPLGILDSISK VKNAQFWTAPTLPTPTLPMPNLETPNP
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p036701
Represented sequence(s):
BRANA_Darmor_v8.1
BRANA_Tapidor_v6.3
BRANA_v5.0
| 1. | 2. | 3. | 4. | 5. | 6. | |
|---|---|---|---|---|---|---|
| 1. BnaA04g24330.1D2 | 0.00 | 3.85 | -0.00 | 4.14 | -0.00 | 3.85 |
| 2. BnaC04g51000.1D2 | 3.85 | 0.00 | 3.85 | -0.00 | 3.85 | -0.00 |
| 3. BnaC01g26810.1T | -0.00 | 3.85 | 0.00 | 4.14 | -0.00 | 3.85 |
| 4. BnaC04g50230.1T | 4.14 | -0.00 | 4.14 | 0.00 | 4.14 | -0.00 |
| 5. GSBRNA2T00005447001 | -0.00 | 3.85 | -0.00 | 4.14 | 0.00 | 3.84 |
| 6. GSBRNA2T00155369001 | 3.85 | -0.00 | 3.85 | -0.00 | 3.84 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G37390.1 | orthology | 0.253 | 3 | - | - |
| MELO3C003095.2.1 | orthology | 1 | 5 | 150 | 2.76e-44 |
| braol_pan_p021666 | orthology | 0.0255 | 2 | 444 | 3.66e-159 |
| brarr_pan_p002630 | orthology | 0.0217 | 1 | 449 | 7.06e-162 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_09762.1 | orthology | 1 | 6 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_37472.1 | orthology | 1 | 7 | - | - |
| cicar_pan_p008704 | orthology | 1 | 6 | 163 | 1.35e-49 |
| cicar_pan_p017889 | orthology | 1 | 6 | - | - |
| cucsa_pan_p020833 | orthology | 1 | 5 | 141 | 1.05e-40 |
| medtr_pan_p001385 | orthology | 1 | 6 | - | - |
| medtr_pan_p025678 | orthology | 1 | 6 | 161 | 1.76e-48 |
| phavu.G19833.gnm2.ann1.Phvul.001G171400.1 | orthology | 1 | 7 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.L001741.1 | orthology | 1 | 7 | - | - |
| soybn_pan_p015281 | orthology | 1 | 7 | - | - |
| soybn_pan_p025035 | orthology | 1 | 7 | - | - |
| soybn_pan_p025142 | orthology | 1 | 6 | - | - |