Gene brana_pan_p042865
Sequence ID | brana_pan_p042865 add to my list | ||
---|---|---|---|
Species | Brassica napus | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 67aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 67 amino acids
>brana_pan_p042865_BRANA MPCEGCVGAVKRVLGKMQGVESFDVDLKEQKVTVKGNVEPEAVLQTVSKTGKKTSFWGAD EAETAKA
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p042865
Represented sequence(s):
BRANA_Tapidor_v6.3
BRANA_v5.0
BRANA_Darmor_v8.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
brana_pan_p007517 | orthology | 0 | 1 | - | - |
brana_pan_p075876 | orthology | 0 | 1 | - | - |
braol_pan_p051279 | orthology | 0.0011 | 2 | - | - |