Gene brana_pan_p044950
| Sequence ID | brana_pan_p044950 add to my list | ||
|---|---|---|---|
| Species | Brassica napus | ||
| Alias | No gene alias | ||
| Pangenome status | Dispensable (2/3) | ||
| Length | 138aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 138 amino acids
>brana_pan_p044950_BRANA MTVEIRVPNLDCEGCASKLKKTLLKLKGVEEVEVEMESQKVTARGYRLEEKKVLKAVRRA GKAAEPWPYRLGNSHFASFYKYPSYVTNHYYSDAHRTDPTGGVHTFFHTPAVYSVAVAGD EIAASMFSDDNPHACTIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p044950
Represented sequence(s):
Unrepresented genome(s):
BRANA_v5.0
BRANA_Darmor_v8.1
BRANA_Tapidor_v6.3
| 1. | 2. | 3. | |
|---|---|---|---|
| 1. BnaA06g16940.1D2 | 0.00 | -0.00 | -0.00 |
| 2. GSBRNA2T00121686001 | -0.00 | 0.00 | -0.00 |
| 3. GSBRNA2T00125369001 | -0.00 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G48970.1 | orthology | 0.0292 | 2 | 268 | 2.62e-94 |
| AUR62015981-RA | orthology | 0.56 | 7 | 201 | 2.68e-66 |
| Bv3_055490_mxet.t1 | orthology | 0.593 | 7 | 199 | 3.87e-67 |
| Ca_8_1007.1 | orthology | 0.487 | 10 | 197 | 5.41e-66 |
| Cc02_g02970 | orthology | 0.487 | 10 | 197 | 1.71e-66 |
| Cg9g026790.1 | orthology | 0.313 | 6 | 204 | 2.28e-69 |
| Cm028340.1 | orthology | 0.313 | 6 | 204 | 3.84e-69 |
| Cs9g17280.1 | orthology | 0.313 | 6 | 204 | 2.48e-69 |
| DCAR_009368 | orthology | 0.566 | 12 | 204 | 4.1e-69 |
| FvH4_7g29520.1 | orthology | 0.353 | 7 | 205 | 1.73e-69 |
| HanXRQChr06g0183831 | orthology | 0.569 | 7 | 195 | 2.18e-65 |
| HanXRQChr09g0253621 | orthology | 0.596 | 7 | - | - |
| MELO3C003319.2.1 | orthology | 0.543 | 7 | 165 | 2.68e-53 |
| Manes.14G025900.1 | orthology | 0.386 | 7 | 204 | 3.76e-69 |
| Mba01_g04690.1 | orthology | 0.815 | 12 | 172 | 1.25e-56 |
| Oeu024220.1 | orthology | 0.462 | 9 | 200 | 2.43e-67 |
| PGSC0003DMP400025270 | orthology | 0.48 | 12 | 205 | 1.99e-69 |
| Solyc03g025790.2.1 | orthology | 0.47 | 12 | 204 | 5.67e-69 |
| braol_pan_p025375 | orthology | 0.001 | 2 | 276 | 1.44e-97 |
| brarr_pan_p005835 | orthology | 0.001 | 2 | 276 | 1.29e-97 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.294 | 6 | 214 | 3.93e-73 |
| capan_pan_p012989 | orthology | 0.493 | 11 | 201 | 7.06e-68 |
| cucsa_pan_p007884 | orthology | 0.51 | 7 | 171 | 7.53e-56 |
| evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.779 | 10 | 166 | 2.13e-54 |
| ipotf_pan_p019855 | orthology | 0.492 | 11 | 191 | 4.43e-64 |
| ipotf_pan_p021461 | orthology | 0.664 | 11 | - | - |
| itb03g13280.t1 | orthology | 0.492 | 11 | 191 | 4.79e-64 |
| itb12g25750.t1 | orthology | 0.651 | 11 | - | - |
| maldo_pan_p005834 | orthology | 0.359 | 7 | 206 | 6.92e-70 |
| maldo_pan_p046866 | orthology | 0.784 | 7 | - | - |
| medtr_pan_p031372 | orthology | 0.277 | 4 | 226 | 6.88e-78 |
| musac_pan_p029616 | orthology | 0.802 | 12 | 173 | 9.7e-57 |
| phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.292 | 6 | 218 | 1.72e-74 |
| soybn_pan_p030070 | orthology | 0.268 | 5 | 185 | 1.18e-61 |
| thecc_pan_p002573 | orthology | 0.333 | 7 | 207 | 2.08e-70 |
| vitvi_pan_p028565 | orthology | 0.405 | 6 | 195 | 1.72e-65 |