Gene brana_pan_p048851


Sequence ID brana_pan_p048851  add to my list
Species Brassica napus
Alias No gene alias
Pangenome status Specific (1/3)
Length 112aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 112 amino acids

>brana_pan_p048851_BRANA
MSEKQRQCCVVMRINLDCNACCRKVRRIVINMKGIDTHMIEKKEDRIIVCGRFRPSDVVV
KLQKKMKRRVEILEVEDLTGGEEGFHDHEPPYEPDHEYSEQQPDHMTMPFLF




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR036163
Figure 1: IPR domains for brana_pan_p048851



Represented sequence(s):
BRANA_v5.0
GSBRNA2T00078000001
GSBRNA2T00139210001
Unrepresented genome(s):
BRANA_Darmor_v8.1
BRANA_Tapidor_v6.3
Download sequences FASTA

  1. 2.
1. GSBRNA2T00078000001 0.00 5.51
2. GSBRNA2T00139210001 5.51 0.00


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT3G25855.1 orthology 0.261 3 160 1.26e-52
Cg7g014560.1 orthology 0.964 7 107 1.47e-30
Cm038010.1 orthology 0.965 8 107 2.59e-30
Cs7g13150.1 orthology 0.965 8 107 1.64e-30
FvH4_4g27630.1 orthology 1 6 105 5.44e-31
Manes.06G070100.1 orthology 0.826 4 - -
Manes.14G100500.1 orthology 0.748 4 114 1.45e-34
braol_pan_p038631 orthology 0.0463 2 218 4.26e-75
brarr_pan_p017699 orthology 0.0187 1 225 3.37e-78
maldo_pan_p037558 orthology 1 6 - -
maldo_pan_p044634 orthology 1 6 - -
maldo_pan_p046030 orthology 0.982 6 - -
maldo_pan_p049521 orthology 1 6 - -
maldo_pan_p049537 orthology 0.991 6 109 2.12e-32
maldo_pan_p055366 orthology 1 6 - -