Gene brana_pan_p049412
| Sequence ID | brana_pan_p049412 add to my list | ||
|---|---|---|---|
| Species | Brassica napus | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 153aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 153 amino acids
>brana_pan_p049412_BRANA MGVLDHVSEYFDCSNGDSKRHRSLQTVDVRVLIDCEGCERKVRRALEGMKGVRDVTIEPN AQKVTVVGYVEPNKVVARIIHRTGKRAELYPYVPYDVVAHPYASGVYDNRAPVGYVRNTE YDPHVSRLARASSTEVRYTTAFSDENASGCVVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brana_pan_p049412
Represented sequence(s):
BRANA_v5.0
BRANA_Tapidor_v6.3
BRANA_Darmor_v8.1
| 1. | 2. | 3. | 4. | 5. | 6. | |
|---|---|---|---|---|---|---|
| 1. BnaA01g05520.1D2 | 0.00 | 1.98 | 1.98 | -0.00 | -0.00 | 1.98 |
| 2. BnaC01g03070.1D2 | 1.98 | 0.00 | -0.00 | 1.98 | 1.98 | -0.00 |
| 3. BnaC01g04160.1T | 1.98 | -0.00 | 0.00 | 1.98 | 1.98 | -0.00 |
| 4. BnaC01g04260.1T | -0.00 | 1.98 | 1.98 | 0.00 | -0.00 | 1.98 |
| 5. GSBRNA2T00007457001 | -0.00 | 1.98 | 1.98 | -0.00 | 0.00 | 1.98 |
| 6. GSBRNA2T00130892001 | 1.98 | -0.00 | -0.00 | 1.98 | 1.98 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT4G35060.1 | orthology | 0.0534 | 3 | 302 | 1.42e-107 |
| braol_pan_p027537 | orthology | 0.0198 | 2 | 309 | 6.43e-110 |
| brarr_pan_p033753 | orthology | 0 | 1 | 315 | 2.95e-112 |