Gene brana_pan_p051583
| Sequence ID | brana_pan_p051583 add to my list |
|---|---|
| Species | Brassica napus |
| Alias | No gene alias |
| Pangenome status | Specific (1/3) |
| Length | 86aa |
Length: 86 amino acids
>brana_pan_p051583_BRANA MAASTGGGKAKYIIGALIGSFGISYLFDKVISDNKIFGGNTPGTVSNKEWWKATDEKFQA WPRTAGPPVVMNPISRQNFIVKSRPE
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for brana_pan_p051583
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT1G01170.1 | orthology | 0.0698 | 1 | 162 | 2.17e-54 |
| FvH4_3g28670.1 | orthology | 0.482 | 4 | 130 | 8.9e-42 |
| FvH4_5g27260.1 | orthology | 0.607 | 4 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_09476.1 | orthology | 0.87 | 6 | 123 | 8e-39 |
| cicar_pan_p021438 | orthology | 0.914 | 4 | - | - |
| cicar_pan_p021882 | orthology | 0.914 | 4 | 124 | 4.49e-39 |
| maldo_pan_p050830 | orthology | 0.465 | 4 | 134 | 9.01e-43 |
| medtr_pan_p001744 | orthology | 0.928 | 5 | 113 | 1.21e-34 |
| medtr_pan_p009141 | orthology | 0.929 | 5 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.001G134700.2 | orthology | 0.868 | 7 | 119 | 5.03e-37 |
| soybn_pan_p000766 | orthology | 0.921 | 7 | - | - |
| soybn_pan_p008913 | orthology | 0.937 | 7 | 123 | 1.75e-38 |
| soybn_pan_p014436 | orthology | 0.95 | 7 | - | - |
| soybn_pan_p035092 | orthology | 0.936 | 7 | - | - |