Gene braol_pan_p002645
| Sequence ID | braol_pan_p002645 add to my list | ||
|---|---|---|---|
| Species | Brassica oleracea | ||
| Alias | No gene alias | ||
| Pangenome status | Specific (1/3) | ||
| Length | 223aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 223 amino acids
>braol_pan_p002645_BRAOL MVCECDVEKKKKERAVHVVLQVDLHCDGCISRIVRLAGCLEGVETVRADPVSNKLTLIGF MDKLQKKTNKKIELLSPKPKKDTSKLNNHAKADVKTTMIAVSTVSLKLNCACDGCITRIH KTISKTKGVYQVKIDREMEVVSVTGTMEVKTVTENLKRKLKKTVQVVPEKKDKKKENAEG ISKSGSPGLPCYGFNYGLGPYGFLGGPITELFSREDPNSCCVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p002645
Represented sequence(s):
Unrepresented genome(s):
BRAOL_TO1000
BRAOL_A2_v1.0
BRAOL_HDEM
| 1. | 2. | |
|---|---|---|
| 1. NC_027751.1_cds_XP_013635518.1_21501 | 0.00 | -0.00 |
| 2. NC_027751.1_cds_XP_013635519.1_21502 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G28090.1 | orthology | 0.382 | 2 | 259 | 8.22e-88 |
| Cg8g019570.1 | orthology | 1 | 8 | - | - |
| Cm049010.1 | orthology | 1 | 9 | - | - |
| Cm049020.1 | orthology | 1 | 8 | - | - |
| Cs8g15890.1 | orthology | 1 | 9 | - | - |
| Cs8g15900.1 | orthology | 1 | 8 | - | - |
| DCAR_015174 | orthology | 1 | 3 | - | - |
| Manes.04G015400.1 | orthology | 1 | 7 | - | - |
| Manes.11G150800.1 | orthology | 1 | 7 | - | - |
| Manes.11G150900.1 | orthology | 1 | 7 | - | - |
| brana_pan_p035445 | orthology | 0.013 | 1 | 426 | 5.86e-154 |
| braol_pan_p042787 | ultra-paralogy | 0.0286 | 0 | - | - |
| thecc_pan_p013140 | orthology | 1 | 4 | - | - |
| vitvi_pan_p000499 | orthology | 1 | 6 | - | - |