Gene braol_pan_p005703
Sequence ID | braol_pan_p005703 add to my list | ||
---|---|---|---|
Species | Brassica oleracea | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (2/3) | ||
Length | 178aa | ||
Gene Ontology |
![]()
|
Length: 178 amino acids
>braol_pan_p005703_BRAOL MGLRSIISTITYGLFLGYPHKKPKVKSVSHLNYYHTMPKARPLSLQTIDLKVRMCCSGCE RVVKHAIYKLRGVDSVEVNLELERVTVVGYVERKKVLKAVRRAGKRAEFWPYPDMPRYFT SSDHYFKDTTREFRESYNYYRHGYNLSDRHGHIHVTNRGDDKVSNFFNDDNVHACRLM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p005703
Represented sequence(s):
Unrepresented genome(s):
BRAOL_HDEM
BRAOL_TO1000
BRAOL_A2_v1.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT2G18196.1 | orthology | 0.0703 | 3 | 298 | 3.11e-105 |
brana_pan_p040174 | orthology | 0.0011 | 2 | 224 | 3.66e-76 |
brarr_pan_p015631 | orthology | 0 | 1 | 330 | 1.1e-117 |
cajca.ICPL87119.gnm1.ann1.C.cajan_07046.1 | orthology | 0.5 | 6 | - | - |
cicar_pan_p015078 | orthology | 0.465 | 5 | 205 | 5.83e-69 |
medtr_pan_p021766 | orthology | 0.552 | 5 | 181 | 6.89e-59 |
phavu.G19833.gnm2.ann1.Phvul.007G117600.1 | orthology | 0.458 | 5 | 204 | 1.09e-67 |
soybn_pan_p021167 | orthology | 0.479 | 6 | 199 | 8.76e-66 |
soybn_pan_p023045 | orthology | 0.489 | 6 | - | - |