Gene braol_pan_p006661
| Sequence ID | braol_pan_p006661 add to my list | ||
|---|---|---|---|
| Species | Brassica oleracea | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 151aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 151 amino acids
>braol_pan_p006661_BRAOL MGDLQIVPAYNKVEAQYVEMMVPLYSYGCEKKIKKALSHLKGIYSVKVDYYKQKVTVWGI CNKLDVLAMVKKKRKEARFWNAEENDQESVDDTIVQKEDTVKTSSDSDKSSAFYTYSPSS PRFKRPPLSLIRTSSFTWKAVKKVFSRSISF
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP342521 | Unannotated cluster |
| 4 | GP077751 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p006661
Represented sequence(s):
BRAOL_TO1000
BRAOL_HDEM
BRAOL_A2_v1.0
| 1. | 2. | 3. | 4. | |
|---|---|---|---|---|
| 1. Bol013080 | 0.00 | 4.06 | -0.00 | -0.00 |
| 2. BolC1p02327H | 4.06 | 0.00 | 4.06 | 4.17 |
| 3. NC_027748.1_cds_XP_013589157.1_2427 | -0.00 | 4.06 | 0.00 | -0.00 |
| 4. NC_027748.1_cds_XP_013589162.1_2428 | -0.00 | 4.17 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT4G27590.2 | orthology | 0.139 | 3 | 238 | 1.2e-79 |
| brana_pan_p032804 | orthology | 0 | 1 | 297 | 2.3e-105 |
| brarr_pan_p021827 | orthology | 0.0062 | 2 | 296 | 7.55e-105 |