Gene braol_pan_p031860
Sequence ID | braol_pan_p031860 add to my list | ||
---|---|---|---|
Species | Brassica oleracea | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 166aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 166 amino acids
>braol_pan_p031860_BRAOL MSQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGKVEPEAVFQTVSKT GKKTSYWPVEAEAEPNAEAEPKVETETKPEAETKTEGKVVEVLGAKVDATKVEPEADVEP KLAETETKTEGKADDEVLDAKVDPKVDAKADVEQKLVEAETKPPQV
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p031860
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G56240.1 | orthology | 0.231 | 2 | - | - |
brana_pan_p026835 | orthology | 0.0064 | 1 | 190 | 2.04e-62 |