Gene braol_pan_p034893
| Sequence ID | braol_pan_p034893 add to my list | ||
|---|---|---|---|
| Species | Brassica oleracea | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 137aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 137 amino acids
>braol_pan_p034893_BRAOL MTKEKKKDNVRFMDVEFNVSMHCNECERKIARVISKFKGVETFTTDMNGHKVVVTGRLDP KKLLKKLRKKTGKRVKIVAKDDKDDESSKYAEDENVLVIDMELIGLGDEQVLGYNDRELE KFMWFSDENPKSICCIS
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP343847 | Unannotated cluster |
| 4 | GP466810 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p034893
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G21490.1 | orthology | 0.292 | 2 | 191 | 3.34e-64 |
| Ca_27_985.2 | orthology | 1 | 11 | - | - |
| Ca_34_139.2 | orthology | 1 | 11 | - | - |
| Ca_43_446.2 | orthology | 1 | 10 | - | - |
| Cc03_g02440 | orthology | 1 | 10 | 76.6 | 3.58e-19 |
| Cg9g003840.1 | orthology | 1 | 9 | 102 | 5.01e-29 |
| Cm135610.1 | orthology | 1 | 9 | 102 | 4.32e-29 |
| Cs9g05250.1 | orthology | 1 | 8 | 112 | 5.74e-33 |
| DCAR_030575 | orthology | 1 | 9 | 88.6 | 1.71e-23 |
| FvH4_3g29750.1 | orthology | 1 | 8 | 104 | 8.8e-30 |
| FvH4_4g16960.1 | orthology | 1 | 8 | - | - |
| HanXRQChr08g0226491 | orthology | 1 | 9 | - | - |
| MELO3C021374.2.1 | orthology | 1 | 9 | 100 | 3.71e-28 |
| Manes.15G018700.1 | orthology | 0.943 | 4 | 115 | 3e-34 |
| Solyc03g098650.2.1 | orthology | 1 | 9 | 94.4 | 7.97e-26 |
| brana_pan_p026722 | orthology | 0.0303 | 2 | 266 | 1.28e-93 |
| brarr_pan_p010495 | orthology | 0.037 | 2 | 264 | 1.2e-92 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04222.1 | orthology | 1 | 10 | 108 | 2.43e-31 |
| cicar_pan_p022803 | orthology | 1 | 10 | 95.9 | 8.64e-27 |
| cucsa_pan_p017292 | orthology | 1 | 9 | 97.8 | 2.73e-27 |
| medtr_pan_p033077 | orthology | 1 | 10 | 105 | 4.98e-30 |
| phavu.G19833.gnm2.ann1.Phvul.003G099700.1 | orthology | 1 | 11 | 107 | 7.47e-31 |
| soybn_pan_p008694 | orthology | 1 | 11 | 103 | 3.29e-29 |
| soybn_pan_p032351 | orthology | 1 | 11 | - | - |
| thecc_pan_p001371 | orthology | 0.978 | 5 | 111 | 1e-32 |
| vitvi_pan_p022438 | orthology | 1 | 7 | 94.7 | 5.49e-26 |
| vitvi_pan_p032656 | orthology | 1 | 7 | - | - |