Gene braol_pan_p038631
Sequence ID | braol_pan_p038631 add to my list | ||
---|---|---|---|
Species | Brassica oleracea | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 112aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 112 amino acids
>braol_pan_p038631_BRAOL MSEKQRQCCVVMRINLDCNACCRKVRRIVINMKGIDTHMIEKKEDRIIVCGRFRPSDVVV KLQKKMKRRVEILEVGDLTGREEGFHDHETPYEPEHEYSEQQPDHMTMPLLF
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP109350 | Unannotated cluster |
3 | GP119142 | Unannotated cluster |
4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p038631
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G25855.1 | orthology | 0.283 | 2 | - | - |
Cg7g014560.1 | orthology | 0.986 | 6 | - | - |
Cm038010.1 | orthology | 0.986 | 7 | - | - |
Cs7g13150.1 | orthology | 0.986 | 7 | - | - |
FvH4_4g27630.1 | orthology | 1 | 5 | - | - |
Manes.06G070100.1 | orthology | 0.848 | 3 | - | - |
Manes.14G100500.1 | orthology | 0.77 | 3 | - | - |
brana_pan_p048851 | orthology | 0.0463 | 2 | 218 | 2.33e-75 |
brarr_pan_p017699 | orthology | 0.064 | 2 | 213 | 1.81e-73 |
maldo_pan_p037558 | orthology | 1 | 5 | - | - |
maldo_pan_p044634 | orthology | 1 | 5 | - | - |
maldo_pan_p046030 | orthology | 1 | 5 | - | - |
maldo_pan_p049521 | orthology | 1 | 5 | - | - |
maldo_pan_p049537 | orthology | 1 | 5 | - | - |
maldo_pan_p055366 | orthology | 1 | 5 | - | - |