Gene braol_pan_p039277
Sequence ID | braol_pan_p039277 add to my list | ||
---|---|---|---|
Species | Brassica oleracea | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 121aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 121 amino acids
>braol_pan_p039277_BRAOL MDCEGCERRVRKSVQGMKGVTKVTVDPKQSKLTVEGFVQPNKVVRRVMHRTGKKAELWPY VPYEVVPHPYAPGAYDKKAPPGYVRNALADPLVAPLARASSFEVKYTSAFSDDNPNACTI M
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p039277
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT5G66110.1 | orthology | 0.0385 | 2 | 243 | 9.48e-85 |
Cg1g001350.1 | orthology | 0.441 | 9 | - | - |
Cm173610.1 | orthology | 0.434 | 8 | - | - |
Cm280940.1 | orthology | 0.434 | 8 | - | - |
Cs1g25820.1 | orthology | 0.434 | 9 | - | - |
MELO3C007926.2.1 | orthology | 0.322 | 4 | - | - |
Manes.01G148900.1 | orthology | 0.383 | 4 | - | - |
brana_pan_p030902 | orthology | 0.0092 | 2 | 248 | 1.15e-86 |
brarr_pan_p021369 | orthology | 0.0092 | 2 | 248 | 9.31e-87 |
cucsa_pan_p018650 | orthology | 0.323 | 4 | - | - |
maldo_pan_p003753 | orthology | 0.375 | 6 | 206 | 4.17e-70 |
medtr_pan_p005386 | orthology | 0.518 | 8 | 206 | 1.02e-69 |
thecc_pan_p011891 | orthology | 0.447 | 8 | - | - |