Gene braol_pan_p039287
| Sequence ID | braol_pan_p039287 add to my list | ||
|---|---|---|---|
| Species | Brassica oleracea | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 150aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 150 amino acids
>braol_pan_p039287_BRAOL MNCCFPPSGKNITISTLDVELKIPDCNKCGKGMISAISNFKGVASYTKDTENQKVAVSGS FDLEKLLKKLKKVTGGKGVEVVKEEEKDPEPEIVEVVKEKDEETEVVQEVKTEENARPEM VFEPNSDEQKEKEKYMLFSDENPNAKCTIS
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP243165 | Unannotated cluster |
| 3 | GP349495 | Unannotated cluster |
| 4 | GP474238 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p039287
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT4G15562.1 | orthology | 1 | 2 | 66.2 | 6.88e-15 |
| brana_pan_p044045 | orthology | 0.0182 | 1 | 175 | 9.77e-58 |