Gene braol_pan_p039287
Sequence ID | braol_pan_p039287 add to my list | ||
---|---|---|---|
Species | Brassica oleracea | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 150aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 150 amino acids
>braol_pan_p039287_BRAOL MNCCFPPSGKNITISTLDVELKIPDCNKCGKGMISAISNFKGVASYTKDTENQKVAVSGS FDLEKLLKKLKKVTGGKGVEVVKEEEKDPEPEIVEVVKEKDEETEVVQEVKTEENARPEM VFEPNSDEQKEKEKYMLFSDENPNAKCTIS
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP243165 | Unannotated cluster |
3 | GP349495 | Unannotated cluster |
4 | GP474238 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for braol_pan_p039287
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT4G15562.1 | orthology | 1 | 2 | 66.2 | 6.88e-15 |
brana_pan_p044045 | orthology | 0.0182 | 1 | 175 | 9.77e-58 |