Gene braol_pan_p052965
| Sequence ID | braol_pan_p052965 add to my list |
|---|---|
| Species | Brassica oleracea |
| Alias | No gene alias |
| Pangenome status | Specific (1/3) |
| Length | 95aa |
Length: 95 amino acids
>braol_pan_p052965_BRAOL KKSISSNSSVDVGCVPCQDKFFKIVSKMTRIEEYVVDVKNKLVMARGDFKPRLVSHQQAN NVASQTLSRNAKHFFRPLNLFLCSIFSMCLCPQTF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP022701 | Unannotated cluster |
| 3 | GP047979 | Unannotated cluster |
| 4 | GP472665 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G35730.1 | orthology | 0.422 | 2 | - | - |
| Cm212920.1 | orthology | 1 | 6 | - | - |
| Manes.02G038800.1 | orthology | 1 | 6 | - | - |
| brana_pan_p054319 | orthology | 0.0011 | 1 | 193 | 5.88e-66 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_01523.1 | orthology | 1 | 7 | - | - |
| cicar_pan_p024775 | orthology | 1 | 6 | - | - |
| cucsa_pan_p023048 | orthology | 1 | 6 | - | - |
| maize_pan_p044279 | orthology | 0.902 | 3 | - | - |
| medtr_pan_p004416 | orthology | 1 | 6 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.003G219900.1 | orthology | 1 | 7 | 42.7 | 1.53e-06 |
| soybn_pan_p039239 | orthology | 1 | 6 | - | - |
| soybn_pan_p043513 | orthology | 1 | 6 | - | - |
| soybn_pan_p045249 | orthology | 1 | 6 | - | - |