Gene braol_pan_p054491
| Sequence ID | braol_pan_p054491 add to my list |
|---|---|
| Species | Brassica oleracea |
| Alias | No gene alias |
| Pangenome status | Specific (1/3) |
| Length | 80aa |
Length: 80 amino acids
>braol_pan_p054491_BRAOL MSRGKYIVGALVGSAVVAYVCDKVISDDKIFGGSTPGTITNKAWGAATEERLQAWPRTAG PPVVMNPISRQNFIVKSRPE
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for braol_pan_p054491
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT4G00860.1 | orthology | 0.12 | 1 | - | - |
| FvH4_3g28670.1 | orthology | 0.702 | 4 | - | - |
| FvH4_5g27260.1 | orthology | 0.827 | 4 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_09476.1 | orthology | 1 | 6 | 121 | 3.63e-38 |
| cicar_pan_p021438 | orthology | 1 | 4 | - | - |
| cicar_pan_p021882 | orthology | 1 | 4 | - | - |
| maldo_pan_p050830 | orthology | 0.684 | 4 | - | - |
| medtr_pan_p001744 | orthology | 1 | 5 | - | - |
| medtr_pan_p009141 | orthology | 1 | 5 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.001G134700.2 | orthology | 1 | 7 | 118 | 7.95e-37 |
| soybn_pan_p000766 | orthology | 1 | 7 | 122 | 3.39e-38 |
| soybn_pan_p008913 | orthology | 1 | 7 | - | - |
| soybn_pan_p014436 | orthology | 1 | 7 | - | - |
| soybn_pan_p035092 | orthology | 1 | 7 | - | - |