Gene brarr_pan_p006703
| Sequence ID | brarr_pan_p006703 add to my list | ||
|---|---|---|---|
| Species | Brassica rapa subsp. rapa | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 240aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 240 amino acids
>brarr_pan_p006703_BRARR MGKQNNNNNKENKGDGGGEKKTASVTVVLKIDMHCEGCASKIVKCVRTFQGVETVKSESE SGKLTVTGDVDPAKLREKLEEKTKKKVDLAAVTTAVLEVDFHCQGCIGKIQKTVTRTKGV NGLTMDKEKQLLTVKGTMDVKKLADTLSEKLKRKVEVVPPAKKDKENGKGKENESGDKKK GGDGGGKDNKGGEGVNAMEYVAAQPAYGAAYYPGGPYGYPIQAHAPQMFSDENVNACVVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP474217 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brarr_pan_p006703
Represented sequence(s):
BRARR_Z1
BRARR_v3.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT5G60800.2 | orthology | 0.263 | 2 | - | - |
| brana_pan_p067841 | orthology | 0.0044 | 1 | 395 | 1.47e-140 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_21570.1 | orthology | 0.975 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_25550.1 | orthology | 1 | 3 | - | - |
| cicar_pan_p020480 | orthology | 0.832 | 4 | - | - |
| cicar_pan_p021432 | orthology | 0.868 | 4 | - | - |
| medtr_pan_p011734 | orthology | 0.959 | 4 | - | - |
| medtr_pan_p013059 | orthology | 0.92 | 4 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.005G131500.1 | orthology | 1 | 4 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.011G084200.1 | orthology | 0.869 | 4 | - | - |
| soybn_pan_p003591 | orthology | 0.939 | 4 | - | - |
| soybn_pan_p023786 | orthology | 0.877 | 5 | - | - |
| soybn_pan_p027875 | orthology | 1 | 5 | - | - |
| soybn_pan_p029836 | orthology | 0.872 | 5 | - | - |