Gene brarr_pan_p008731


Sequence ID brarr_pan_p008731  add to my list
Species Brassica rapa subsp. rapa
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 73aa



Length: 73 amino acids

>brarr_pan_p008731_BRARR
MDVKKLVRSLTEKLKRSVEIVATAKNGNAKEKQYVAAQPAHGSAYFPGEDGDTIEYLAPQ
IFSDDNPNACVVM





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545
Heavy metal transport/detoxification group1
3 GP342504 Unannotated cluster
4 GP508342 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


No IPR domain.




Represented sequence(s):
BRARR_v3.0
Unrepresented genome(s):
BRARR_Z1

  1. 2.
1. BraAnng001290.3C 0.00 -0.00
2. BraAnng001300.3C -0.00 0.00


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT5G60800.2 orthology 0.44 2 - -
braol_pan_p002717 orthology 0.0362 1 - -
brarr_pan_p020733 ultra-paralogy 0.001 0 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_21570.1 orthology 1 5 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_25550.1 orthology 1 3 - -
cicar_pan_p020480 orthology 1 4 - -
cicar_pan_p021432 orthology 1 4 - -
medtr_pan_p011734 orthology 1 4 - -
medtr_pan_p013059 orthology 1 4 - -
phavu.G19833.gnm2.ann1.Phvul.005G131500.1 orthology 1 4 - -
phavu.G19833.gnm2.ann1.Phvul.011G084200.1 orthology 1 4 - -
soybn_pan_p003591 orthology 1 4 - -
soybn_pan_p023786 orthology 1 5 - -
soybn_pan_p027875 orthology 1 5 - -
soybn_pan_p029836 orthology 1 5 - -