Gene brarr_pan_p008731
Sequence ID | brarr_pan_p008731 add to my list |
---|---|
Species | Brassica rapa subsp. rapa |
Alias | No gene alias |
Pangenome status | Dispensable (1/2) |
Length | 73aa |
Length: 73 amino acids
>brarr_pan_p008731_BRARR MDVKKLVRSLTEKLKRSVEIVATAKNGNAKEKQYVAAQPAHGSAYFPGEDGDTIEYLAPQ IFSDDNPNACVVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP508342 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
1. | 2. | |
---|---|---|
1. BraAnng001290.3C | 0.00 | -0.00 |
2. BraAnng001300.3C | -0.00 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT5G60800.2 | orthology | 0.44 | 2 | - | - |
braol_pan_p002717 | orthology | 0.0362 | 1 | - | - |
brarr_pan_p020733 | ultra-paralogy | 0.001 | 0 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_21570.1 | orthology | 1 | 5 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_25550.1 | orthology | 1 | 3 | - | - |
cicar_pan_p020480 | orthology | 1 | 4 | - | - |
cicar_pan_p021432 | orthology | 1 | 4 | - | - |
medtr_pan_p011734 | orthology | 1 | 4 | - | - |
medtr_pan_p013059 | orthology | 1 | 4 | - | - |
phavu.G19833.gnm2.ann1.Phvul.005G131500.1 | orthology | 1 | 4 | - | - |
phavu.G19833.gnm2.ann1.Phvul.011G084200.1 | orthology | 1 | 4 | - | - |
soybn_pan_p003591 | orthology | 1 | 4 | - | - |
soybn_pan_p023786 | orthology | 1 | 5 | - | - |
soybn_pan_p027875 | orthology | 1 | 5 | - | - |
soybn_pan_p029836 | orthology | 1 | 5 | - | - |