Gene brarr_pan_p009918
Sequence ID | brarr_pan_p009918 add to my list | ||
---|---|---|---|
Species | Brassica rapa subsp. rapa | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 153aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 153 amino acids
>brarr_pan_p009918_BRARR MGALNFLSGYFSDHFYVSIRKRKKRKVMQQTVNIKVKIDCDGCERKIKNAVSSMKGAKSV EVNRKMHKVTVSGYVDPKKVLKKVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPPGF VRKSEQAQAQPGGTDDKLMSLFSDENPNACTIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brarr_pan_p009918
Represented sequence(s):
BRARR_Z1
BRARR_v3.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT1G22990.1 | orthology | 0.056 | 2 | 288 | 6.02e-102 |
brana_pan_p009070 | orthology | 0 | 1 | 307 | 2.89e-109 |