Gene brarr_pan_p015545
| Sequence ID | brarr_pan_p015545 add to my list | ||
|---|---|---|---|
| Species | Brassica rapa subsp. rapa | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 266aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 266 amino acids
>brarr_pan_p015545_BRARR MGKNKQNGEADNKSRNQKNGDSNKSDTKNQKNGDADKSDKSDKKNQCKEIVLKVYMHCEG CASQVSHCLRGYDGVEQIKTEVGENKVVVSGKFDDPVKILRRVQKKFSKNAELISPKPNP NQDQKKEQQQKKESTPQIKTAILKMNIHCEGCVNEIKRGIEKIKGIQTAEPDRSKSMVVV RGVMDPPKLVEEIKKKLKRHAELVSQNTEKGKGNNDKESNNNNKGNKKNEDSDGNTIFSY PPQYSAQHNYPSQIFSDENVHSCSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brarr_pan_p015545
Represented sequence(s):
BRARR_v3.0
BRARR_Z1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G02960.1 | orthology | 0.158 | 1 | 356 | 2.18e-125 |
| Cg7g016680.1 | orthology | 1 | 6 | 181 | 1.99e-57 |
| Cm174370.1 | orthology | 1 | 5 | 184 | 2.94e-58 |
| Cs7g11080.1 | orthology | 1 | 6 | 195 | 3.49e-62 |
| Manes.13G008700.1 | orthology | 0.971 | 4 | 202 | 2.02e-65 |
| orange1.1t05450.1 | orthology | 1 | 6 | - | - |
| thecc_pan_p009145 | orthology | 0.905 | 3 | 221 | 3.44e-72 |
| thecc_pan_p020513 | orthology | 1 | 3 | - | - |