Gene brarr_pan_p018750
| Sequence ID | brarr_pan_p018750 add to my list | ||
|---|---|---|---|
| Species | Brassica rapa subsp. rapa | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 158aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 158 amino acids
>brarr_pan_p018750_BRARR MLDWIHGHSRFPLALSVVELLVDMDCQGCETKVRRAISKLSGVNTVEIDVDRQKVTVTGY IDREEVLRIVKRTGRAAEFWPFPYNGYYGGYYTYPSQYLEQSNQKINNHGENTISYGGNY NFYEDSSINGYYPRSPQKVDENDIHLFSDDNVHACLVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
|
Heavy-metal-associated, conserved site
IPR017969
|
Heavy-metal-associated, conserved site | Conserved_site |
Figure 1: IPR domains for brarr_pan_p018750
Represented sequence(s):
BRARR_v3.0
BRARR_Z1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G56891.1 | orthology | 0.244 | 1 | - | - |
| Ca_28_123.1 | orthology | 1 | 6 | - | - |
| Ca_31_155.3 | orthology | 1 | 6 | - | - |
| Ca_64_676.1 | orthology | 1 | 6 | - | - |
| Ca_78_1273.1 | orthology | 1 | 6 | - | - |
| Cc06_g21060 | orthology | 0.993 | 6 | - | - |
| Cg6g011520.1 | orthology | 0.91 | 8 | 155 | 2.15e-49 |
| Cs6g10930.1 | orthology | 0.904 | 8 | 149 | 5.65e-47 |
| DCAR_016949 | orthology | 1 | 6 | - | - |
| FvH4_2g26780.1 | orthology | 0.911 | 6 | - | - |
| MELO3C019416.2.1 | orthology | 0.99 | 8 | 129 | 5.44e-39 |
| Manes.08G099200.1 | orthology | 0.858 | 4 | - | - |
| Oeu053981.1 | orthology | 1 | 7 | 105 | 7.77e-30 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 | orthology | 1 | 10 | 137 | 2.11e-42 |
| cucsa_pan_p011351 | orthology | 1 | 8 | 128 | 7.47e-39 |
| ipotf_pan_p003030 | orthology | 1 | 8 | 140 | 2.01e-43 |
| itb11g01700.t1 | orthology | 1 | 8 | 140 | 2.17e-43 |
| maldo_pan_p024328 | orthology | 0.995 | 6 | - | - |
| maldo_pan_p038662 | orthology | 0.902 | 6 | - | - |
| medtr_pan_p030129 | orthology | 0.998 | 8 | 100 | 5.8e-28 |
| phavu.G19833.gnm2.ann1.Phvul.004G052700.1 | orthology | 1 | 9 | 145 | 1.35e-45 |
| soybn_pan_p020075 | orthology | 1 | 10 | - | - |
| thecc_pan_p019791 | orthology | 0.864 | 7 | 133 | 1.34e-40 |
| vitvi_pan_p003255 | orthology | 0.85 | 4 | - | - |