Gene brarr_pan_p021369


Sequence ID brarr_pan_p021369  add to my list
Species Brassica rapa subsp. rapa
Alias No gene alias
Pangenome status Core (2/2)
Length 121aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 121 amino acids

>brarr_pan_p021369_BRARR
MDCEGCERRVRKSVQGMKGVTNVTVDPKQSKLTVEGFVQPNKVVRRVMHRTGKKAELWPY
VPYEVVPHPYAPGAYDKKAPPGYVRNALADPLVAPLARASSFEVKYTSAFSDDNPNACTI
M


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for brarr_pan_p021369



Represented sequence(s):
BRARR_Z1
BraA06t26351Z
BRARR_v3.0
BraA06g030660.3C
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT5G66110.1 orthology 0.0467 3 242 2.72e-84
Cg1g001350.1 orthology 0.449 10 - -
Cm173610.1 orthology 0.443 9 - -
Cm280940.1 orthology 0.443 9 - -
Cs1g25820.1 orthology 0.442 10 - -
MELO3C007926.2.1 orthology 0.331 5 - -
Manes.01G148900.1 orthology 0.391 5 - -
brana_pan_p030902 orthology 0 1 251 6.93e-88
braol_pan_p039277 orthology 0.0092 2 248 5.18e-87
cucsa_pan_p018650 orthology 0.331 5 - -
maldo_pan_p003753 orthology 0.384 7 206 2.94e-70
medtr_pan_p005386 orthology 0.526 9 204 2.93e-69
thecc_pan_p011891 orthology 0.455 9 - -