Gene brarr_pan_p026538
Sequence ID | brarr_pan_p026538 add to my list |
---|---|
Species | Brassica rapa subsp. rapa |
Alias | No gene alias |
Pangenome status | Core (2/2) |
Length | 294aa |
Length: 294 amino acids
>brarr_pan_p026538_BRARR MSFEDDFVEDDEMNMIDEDVASDSEAESLSDSDSENEITEKLAEPTKTAVYNRDGLLDKL QDISWPEDVDWTHKLTVEIEQGQAVDVNDDLAREMAFYTQALEGTRQAFEKLQEMGLPFL RPADYYAEMVKSDTHMEKVKSKLLYEKKQMEEAEERRKARDNKKMAKEVQSQKMKERAKQ KKDEIESVKKWRKQRQQSGFSEKGAGELDLEFGNGKSFQRGGGKKRPGVSPGDRSGGKGK PTSRMNNKKREFRDSKFGHGGRKGLSKQNTAETTNDFKGGFRGGKAGGNKRQKR
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP075980 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Eukaryotic rRNA processing
IPR008610
|
Eukaryotic rRNA processing | Family |
Figure 1: IPR domains for brarr_pan_p026538
Represented sequence(s):
BRARR_Z1
BRARR_v3.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G22660.1 | orthology | 0.131 | 1 | 431 | 5.09e-154 |
PGSC0003DMP400055292 | orthology | 0.575 | 5 | - | - |
PGSC0003DMP400055391 | orthology | 0.559 | 5 | 296 | 1.61e-100 |
Solyc01g006090.2.1 | orthology | 0.573 | 5 | 303 | 2.22e-103 |
Solyc01g006170.2.1 | orthology | 0.557 | 4 | - | - |
capan_pan_p017109 | orthology | 0.654 | 4 | 169 | 3.53e-51 |
ipotf_pan_p017885 | orthology | 0.561 | 4 | 221 | 2.98e-71 |
ipotf_pan_p024335 | orthology | 0.836 | 3 | - | - |
ipotf_pan_p027028 | orthology | 0.604 | 3 | - | - |
itb11g17740.t1 | orthology | 0.553 | 3 | - | - |
itb12g07110.t1 | orthology | 0.558 | 4 | 221 | 3.22e-71 |