Gene brarr_pan_p028890
Sequence ID | brarr_pan_p028890 add to my list | ||
---|---|---|---|
Species | Brassica rapa subsp. rapa | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 156aa | ||
Gene Ontology |
![]()
|
Length: 156 amino acids
>brarr_pan_p028890_BRARR MTTIEMRVHMDCVGCESRVKSALQKMRGVDEVEIDMVQQKVTVTGYADQKKVLKKVRKTG RRAELWQLPFNPDHSSLLGGGSNSTNGGYFYNPHGCNGPINHHAPVPGSSYNYYKHGYDS NDYSSYQHHPVHASIFSHQAGSKFSDENPNAACSIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brarr_pan_p028890
Represented sequence(s):
1. | 2. | 3. | |
---|---|---|---|
1. BraA09t42037Z | 0.00 | 0.64 | 8.66 |
2. BraA09g064020.3C | 0.64 | 0.00 | 99.13 |
3. BraA09g064010.3C | 8.66 | 99.13 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT1G06330.1 | orthology | 0.0869 | 2 | 275 | 9.71e-97 |
Cg2g008690.1 | orthology | 0.532 | 7 | 187 | 4.83e-62 |
Cm103060.1 | orthology | 0.526 | 8 | 187 | 5.72e-62 |
Cs2g15540.1 | orthology | 0.526 | 8 | 189 | 1.15e-62 |
FvH4_6g27360.1 | orthology | 0.475 | 3 | 185 | 4.27e-61 |
MELO3C018725.2.1 | orthology | 0.593 | 6 | 166 | 9.17e-54 |
Manes.15G048400.1 | orthology | 0.421 | 6 | 202 | 6.12e-68 |
brana_pan_p013116 | orthology | 0 | 1 | 321 | 1.17e-114 |
braol_pan_p024201 | orthology | 0 | 1 | 321 | 1.06e-114 |
cajca.ICPL87119.gnm1.ann1.C.cajan_23872.1 | orthology | 0.552 | 9 | 177 | 2.48e-58 |
cucsa_pan_p019751 | orthology | 0.585 | 6 | 169 | 7.45e-55 |
medtr_pan_p000903 | orthology | 0.586 | 7 | 182 | 3.43e-60 |
phavu.G19833.gnm2.ann1.Phvul.005G095400.1 | orthology | 0.56 | 8 | 175 | 2.22e-57 |
soybn_pan_p032804 | orthology | 0.553 | 9 | 180 | 4.74e-59 |
thecc_pan_p014674 | orthology | 0.407 | 7 | 159 | 7.8e-51 |
vitvi_pan_p026446 | orthology | 0.452 | 5 | 193 | 2.79e-64 |