Gene brarr_pan_p028890


Sequence ID brarr_pan_p028890  add to my list
Species Brassica rapa subsp. rapa
Alias No gene alias
Pangenome status Core (2/2)
Length 156aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 156 amino acids

>brarr_pan_p028890_BRARR
MTTIEMRVHMDCVGCESRVKSALQKMRGVDEVEIDMVQQKVTVTGYADQKKVLKKVRKTG
RRAELWQLPFNPDHSSLLGGGSNSTNGGYFYNPHGCNGPINHHAPVPGSSYNYYKHGYDS
NDYSSYQHHPVHASIFSHQAGSKFSDENPNAACSIM



Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397
Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for brarr_pan_p028890



Represented sequence(s):
BRARR_Z1
BRARR_v3.0

  1. 2. 3.
1. BraA09t42037Z 0.00 0.64 8.66
2. BraA09g064020.3C 0.64 0.00 99.13
3. BraA09g064010.3C 8.66 99.13 0.00


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT1G06330.1 orthology 0.0869 2 275 9.71e-97
Cg2g008690.1 orthology 0.532 7 187 4.83e-62
Cm103060.1 orthology 0.526 8 187 5.72e-62
Cs2g15540.1 orthology 0.526 8 189 1.15e-62
FvH4_6g27360.1 orthology 0.475 3 185 4.27e-61
MELO3C018725.2.1 orthology 0.593 6 166 9.17e-54
Manes.15G048400.1 orthology 0.421 6 202 6.12e-68
brana_pan_p013116 orthology 0 1 321 1.17e-114
braol_pan_p024201 orthology 0 1 321 1.06e-114
cajca.ICPL87119.gnm1.ann1.C.cajan_23872.1 orthology 0.552 9 177 2.48e-58
cucsa_pan_p019751 orthology 0.585 6 169 7.45e-55
medtr_pan_p000903 orthology 0.586 7 182 3.43e-60
phavu.G19833.gnm2.ann1.Phvul.005G095400.1 orthology 0.56 8 175 2.22e-57
soybn_pan_p032804 orthology 0.553 9 180 4.74e-59
thecc_pan_p014674 orthology 0.407 7 159 7.8e-51
vitvi_pan_p026446 orthology 0.452 5 193 2.79e-64