Gene brarr_pan_p028890


Sequence ID brarr_pan_p028890  add to my list
Species Brassica rapa subsp. rapa
Alias No gene alias
Pangenome status Core (2/2)
Length 156aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 156 amino acids

>brarr_pan_p028890_BRARR
MTTIEMRVHMDCVGCESRVKSALQKMRGVDEVEIDMVQQKVTVTGYADQKKVLKKVRKTG
RRAELWQLPFNPDHSSLLGGGSNSTNGGYFYNPHGCNGPINHHAPVPGSSYNYYKHGYDS
NDYSSYQHHPVHASIFSHQAGSKFSDENPNAACSIM


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for brarr_pan_p028890



Represented sequence(s):
BRARR_Z1
BraA09t42037Z
BRARR_v3.0
BraA09g064020.3C
BraA09g064010.3C
Download sequences FASTA

  1. 2. 3.
1. BraA09t42037Z 0.00 0.64 8.66
2. BraA09g064020.3C 0.64 0.00 99.13
3. BraA09g064010.3C 8.66 99.13 0.00


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT1G06330.1 orthology 0.0869 2 275 9.71e-97
Cg2g008690.1 orthology 0.532 7 187 4.83e-62
Cm103060.1 orthology 0.526 8 187 5.72e-62
Cs2g15540.1 orthology 0.526 8 189 1.15e-62
FvH4_6g27360.1 orthology 0.475 3 185 4.27e-61
MELO3C018725.2.1 orthology 0.593 6 166 9.17e-54
Manes.15G048400.1 orthology 0.421 6 202 6.12e-68
brana_pan_p013116 orthology 0 1 321 1.17e-114
braol_pan_p024201 orthology 0 1 321 1.06e-114
cajca.ICPL87119.gnm1.ann1.C.cajan_23872.1 orthology 0.552 9 177 2.48e-58
cucsa_pan_p019751 orthology 0.585 6 169 7.45e-55
medtr_pan_p000903 orthology 0.586 7 182 3.43e-60
phavu.G19833.gnm2.ann1.Phvul.005G095400.1 orthology 0.56 8 175 2.22e-57
soybn_pan_p032804 orthology 0.553 9 180 4.74e-59
thecc_pan_p014674 orthology 0.407 7 159 7.8e-51
vitvi_pan_p026446 orthology 0.452 5 193 2.79e-64