Gene brarr_pan_p033912
| Sequence ID | brarr_pan_p033912 add to my list | ||
|---|---|---|---|
| Species | Brassica rapa subsp. rapa | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 141aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 141 amino acids
>brarr_pan_p033912_BRARR MDVPMDCPGCERKVRKALESIKGVHDVQIDMNQQKVTVTGSAEQKKVLKVARSITGREVC LWSCPYHPESNGFNDKYYKKKFRKRIIMSKNGEKVNSYNYYMHGYHGHDHGYHQERPYSG HIDENATSMFSEENPHFCNIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brarr_pan_p033912
Represented sequence(s):
BRARR_v3.0
BRARR_Z1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT1G29100.2 | orthology | 0.229 | 2 | 228 | 1.89e-78 |
| HORVU7Hr1G080490.1 | orthology | 1 | 4 | - | - |
| ORGLA06G0147600.1 | orthology | 1 | 4 | - | - |
| Sspon.08G0007770-1A | orthology | 1 | 5 | - | - |
| Sspon.08G0007770-2B | orthology | 1 | 5 | - | - |
| brana_pan_p026075 | orthology | 0.0141 | 2 | 292 | 1.04e-103 |
| braol_pan_p020359 | orthology | 0.0141 | 2 | 292 | 9.41e-104 |
| maize_pan_p005331 | orthology | 1 | 4 | - | - |
| maize_pan_p039298 | orthology | 1 | 4 | - | - |
| orysa_pan_p021817 | orthology | 1 | 4 | - | - |
| sorbi_pan_p008889 | orthology | 1 | 5 | - | - |
| tritu_pan_p011159 | orthology | 1 | 3 | - | - |
| tritu_pan_p011712 | orthology | 1 | 3 | - | - |
| tritu_pan_p042703 | orthology | 1 | 4 | - | - |