Gene brarr_pan_p037797
Sequence ID | brarr_pan_p037797 add to my list | ||
---|---|---|---|
Species | Brassica rapa subsp. rapa | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 165aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 165 amino acids
>brarr_pan_p037797_BRARR MLIGTLGKRAEVLTMTKKSDVVPEKNGQSNIVPKKEANPEIKQTDVKPERSIREVEYNLR PASQELEVYIRKVISKFEGVENCVVDIQNKRIVVTGDFDQKKLFEELQKKRRKIIKKDHE LIEKYRRIHARVRSGDEKEMAKFDMSNEENPNGALNHHKKLGMVI
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP246754 | Unannotated cluster |
3 | GP351161 | Unannotated cluster |
4 | GP480573 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brarr_pan_p037797
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
brana_pan_p018519 | orthology | 0 | 1 | 315 | 9.06e-112 |
braol_pan_p019160 | orthology | 0.0879 | 2 | 261 | 2.21e-90 |