Gene brarr_pan_p050124
| Sequence ID | brarr_pan_p050124 add to my list |
|---|---|
| Species | Brassica rapa subsp. rapa |
| Alias | No gene alias |
| Pangenome status | Dispensable (1/2) |
| Length | 78aa |
Length: 78 amino acids
>brarr_pan_p050124_BRARR KEEIDSLLRLPPHKIGVYTANIDVKQKKVTVVGNVEPWILIKKSVGRSEPNLNIFSNNLS SGCGDITCERILYCFSHL
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.