Gene cajca.ICPL87119.gnm1.ann1.C.cajan_04403.1
Sequence ID | cajca.ICPL87119.gnm1.ann1.C.cajan_04403.1 add to my list | ||
---|---|---|---|
Species | Cajanus cajan | ||
Alias | No gene alias | ||
Length | 384aa | ||
Gene Ontology |
![]()
|
Length: 384 amino acids
>cajca.ICPL87119.gnm1.ann1.C.cajan_04403.1_CAJCA MQKSVLKVNIHCDGCKSKVKKILQKIDGVFTIEIDAEQGKVTVSGNVDPNVLIKKLAKSG KHAELWAAPKPNHSNHNNQNQLKNMSIDNMKGGGNHHNQNNKGQNQKDGNNQAKSGGPQG PNPQQQQQLQLQLQQQQRLQQQLQQLQQMKGLQDLNLPQFKVPPHNPNAKAVKFDIPEED EELTEGEFDDEFDEDDEFDEEFDEDEMEEVEASKMKGPKDGGKKGAGAVPVQVHGGGGGK KGGGGAAEGKNKNNGGNNNNNVNGGKKVVNNPMGVQPMNGGFQNVGGPPRVMPMPMPMPM PAVQGLPADAMAGLQQQQQQQYLAMMNQQRAMGNDRFQPMMYARPPPAVNYMYPPYPYPY PPPPPDPYNTHLFSDENTSSCNVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_04403.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg9g004610.1 | orthology | 0.597 | 8 | 182 | 2.16e-52 |
Cm080580.1 | orthology | 0.607 | 8 | 201 | 1.74e-59 |
Cs9g06110.1 | orthology | 0.602 | 7 | 180 | 1.19e-51 |
FvH4_4g14520.1 | orthology | 0.613 | 7 | - | - |
MELO3C006564.2.1 | orthology | 0.61 | 4 | 163 | 1.17e-45 |
Manes.03G184400.1 | orthology | 0.601 | 6 | - | - |
Manes.15G023400.1 | orthology | 0.604 | 6 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_04404.1 | ultra-paralogy | 0.361 | 0 | - | - |
cucsa_pan_p014828 | orthology | 0.624 | 4 | 160 | 9.59e-45 |
maldo_pan_p033071 | orthology | 0.583 | 7 | - | - |
phavu.G19833.gnm2.ann1.Phvul.003G092500.1 | orthology | 0.264 | 2 | - | - |
soybn_pan_p028758 | orthology | 0.19 | 1 | 259 | 5.32e-82 |
soybn_pan_p032758 | orthology | 0.212 | 1 | - | - |
thecc_pan_p006423 | orthology | 0.592 | 6 | - | - |