Gene cajca.ICPL87119.gnm1.ann1.C.cajan_21421.1
| Sequence ID | cajca.ICPL87119.gnm1.ann1.C.cajan_21421.1 add to my list | ||
|---|---|---|---|
| Species | Cajanus cajan | ||
| Alias | No gene alias | ||
| Length | 221aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 221 amino acids
>cajca.ICPL87119.gnm1.ann1.C.cajan_21421.1_CAJCA MKGIDLFCASSASTAVTSRMHHRSMVHRRTKSYDHERRKSQVHVPCSSQLPINPKPYFEK HRKSSADKHNSDMRRKSSVEVNDLYTHHASVDGSSTRYLLGDAPFIEWVSESNKIAAMAP SQRDVKHNPIVRSSSSTRSKDQVVVLRVSLHCKACEGKVRKHISKMEGVTSFSIDMETKK VTIIGDVTPLGVLASVSKVKNAQLWPSPTSSSSRPTSPWST
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_21421.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| FvH4_3g34750.1 | orthology | 0.65 | 3 | 154.8 | 6.1e-38 |
| Manes.04G029700.1 | orthology | 0.662 | 3 | - | - |
| Manes.11G135800.1 | orthology | 0.519 | 3 | 204.9 | 5.9e-53 |
| maldo_pan_p016590 | orthology | 0.685 | 3 | 214 | 4.38e-70 |
| maldo_pan_p031809 | orthology | 0.696 | 3 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.011G068500.1 | orthology | 0.247 | 2 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.011G068700.1 | orthology | 0.235 | 2 | 283.5 | 1.2e-76 |
| soybn_pan_p008062 | orthology | 0.116 | 2 | 350 | 1.25e-123 |
| soybn_pan_p029253 | orthology | 0.137 | 2 | - | - |