Gene cajca.ICPL87119.gnm1.ann1.C.cajan_21570.1
| Sequence ID | cajca.ICPL87119.gnm1.ann1.C.cajan_21570.1 add to my list | ||
|---|---|---|---|
| Species | Cajanus cajan | ||
| Alias | No gene alias | ||
| Length | 267aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 267 amino acids
>cajca.ICPL87119.gnm1.ann1.C.cajan_21570.1_CAJCA MHCDGCASKTLKRLRAFQGVETVKLESDAGKVTVTGKVDPAKLRDYLAEKTKKKVEILSP QNKKEKEKENKDAKTNNKSEDKTDDKKTKDKEVVTTTVLKVAMHCQGCKDRICRIVYKTK GVQEMNVDEEKETVTVKGTVDIKALAGNLTEKLRREVVVVPPKKGKDGEKEGGENEGSGK KKNKGGSGGGDKNENVEVEGEKIYNRIEHLVPPFGFGYGHGHGHGFGHGYVGGYSYVPVY PEQMHLHLHAPPPQMFSDENPHACSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_21570.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT5G60800.2 | orthology | 0.908 | 4 | 124 | 1.4e-28 |
| brana_pan_p000516 | orthology | 1 | 5 | 181 | 6.93e-56 |
| brana_pan_p055950 | orthology | 0.968 | 5 | - | - |
| brana_pan_p067841 | orthology | 0.972 | 5 | - | - |
| braol_pan_p002717 | orthology | 1 | 5 | - | - |
| braol_pan_p017567 | orthology | 1 | 5 | 181 | 2.44e-56 |
| braol_pan_p040048 | orthology | 0.968 | 5 | - | - |
| brarr_pan_p004266 | orthology | 0.992 | 4 | 176 | 3.44e-54 |
| brarr_pan_p006703 | orthology | 0.975 | 5 | - | - |
| brarr_pan_p008731 | orthology | 1 | 5 | - | - |
| brarr_pan_p020733 | orthology | 1 | 5 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.011G084200.1 | orthology | 0.296 | 2 | 177.6 | 1.1e-44 |
| soybn_pan_p023786 | orthology | 0.261 | 1 | - | - |
| soybn_pan_p027875 | orthology | 0.498 | 1 | - | - |
| soybn_pan_p029836 | orthology | 0.255 | 1 | 308 | 9.39e-106 |