Gene cajca.ICPL87119.gnm1.ann1.C.cajan_22288.1
Sequence ID | cajca.ICPL87119.gnm1.ann1.C.cajan_22288.1 add to my list | ||
---|---|---|---|
Species | Cajanus cajan | ||
Alias | No gene alias | ||
Length | 172aa | ||
Gene Ontology |
![]()
|
Length: 172 amino acids
>cajca.ICPL87119.gnm1.ann1.C.cajan_22288.1_CAJCA MSLKSSKRGMMNGFMCHSRASTAVCTCSIDLGSVVVPRTKTRSHERSVSLDDTRLINYAK YSKLVKPTRFNSAHKKSASLSLPNIKHQENESKELQKTPTDNVFQFQVVVMRVAIHCQGC AGKVKKHLSKMEGVTSFSVDVESKRVTVMGHISPMGVLNSISKVKRAEFWNC
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_22288.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
FvH4_5g30890.1 | orthology | 0.735 | 6 | 143.3 | 1.4e-34 |
Oeu026170.2 | orthology | 0.817 | 4 | - | - |
cocnu_pan_p025689 | orthology | 0.644 | 5 | - | - |
maldo_pan_p006499 | orthology | 0.927 | 6 | - | - |
phavu.G19833.gnm2.ann1.Phvul.006G207900.1 | orthology | 0.274 | 1 | 208.4 | 3.7e-54 |
soybn_pan_p021093 | orthology | 0.134 | 2 | 266 | 1.29e-92 |
soybn_pan_p029731 | orthology | 0.169 | 2 | - | - |