Gene cajca.ICPL87119.gnm1.ann1.C.cajan_25550.1
| Sequence ID | cajca.ICPL87119.gnm1.ann1.C.cajan_25550.1 add to my list |
|---|---|
| Species | Cajanus cajan |
| Alias | No gene alias |
| Length | 236aa |
Length: 236 amino acids
>cajca.ICPL87119.gnm1.ann1.C.cajan_25550.1_CAJCA EGVQRWKTEIDTGKFTVTGNVDRDNKLADKPNNNVQLTSPHSNKDKKPKDKQTPEKTVVL KVSRYCRCRGCFNRLRKAVLKVEGVWVGDDVAINSNDEWWMVTAKCTVDVNVVAGTLSKK LKRVVEVVPPKKEKEKEKEKEKKEKEKEGEKEGDKGGNSATAKKKKKAGGEDNGGGGGAA AADGKGKKDQEENLMYYELPTRDYANGGYGHGNYIDQYNHVAQMFNEENPYACHIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT5G60800.2 | orthology | 1 | 2 | - | - |
| brana_pan_p000516 | orthology | 1 | 3 | - | - |
| brana_pan_p055950 | orthology | 1 | 3 | - | - |
| brana_pan_p067841 | orthology | 1 | 3 | - | - |
| braol_pan_p002717 | orthology | 1 | 3 | - | - |
| braol_pan_p017567 | orthology | 1 | 3 | - | - |
| braol_pan_p040048 | orthology | 1 | 3 | - | - |
| brarr_pan_p004266 | orthology | 1 | 2 | - | - |
| brarr_pan_p006703 | orthology | 1 | 3 | - | - |
| brarr_pan_p008731 | orthology | 1 | 3 | - | - |
| brarr_pan_p020733 | orthology | 1 | 3 | - | - |