Gene cajca.ICPL87119.gnm1.ann1.C.cajan_29968.1
Sequence ID | cajca.ICPL87119.gnm1.ann1.C.cajan_29968.1 add to my list | ||
---|---|---|---|
Species | Cajanus cajan | ||
Alias | No gene alias | ||
Length | 144aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 144 amino acids
>cajca.ICPL87119.gnm1.ann1.C.cajan_29968.1_CAJCA MGFLECFTACSKPAKEKLVPKKTVHLRVKCDCKGCVRKVTDAVEGLEGVESFDVNQKQQR VTVTGYVDSEEVLEQVRNTGKTANIWPFVPYNLVTFPYVKGAYDIKAPSGFVRSVPDAMG DPKSPEMKLMRLFDDDNPDACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_29968.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU3Hr1G049780.1 | orthology | 1 | 4 | - | - |
HORVU5Hr1G069380.4 | orthology | 1 | 4 | - | - |
Sspon.06G0009420-1A | orthology | 1 | 4 | - | - |
Sspon.06G0009420-2B | orthology | 1 | 3 | - | - |
Sspon.06G0009420-3C | orthology | 1 | 3 | - | - |
Sspon.06G0009420-4D | orthology | 1 | 3 | - | - |
Sspon.06G0031050-1C | orthology | 1 | 3 | - | - |
bradi_pan_p033041 | orthology | 1 | 3 | - | - |
maize_pan_p014166 | orthology | 1 | 4 | - | - |
maize_pan_p018098 | orthology | 1 | 3 | - | - |
orysa_pan_p050041 | orthology | 1 | 3 | - | - |
phavu.G19833.gnm2.ann1.Phvul.003G022400.1 | orthology | 0.251 | 2 | 234.6 | 4e-62 |
sorbi_pan_p010234 | orthology | 1 | 3 | - | - |
soybn_pan_p016584 | orthology | 0.193 | 1 | 241 | 1.5e-83 |
tritu_pan_p004483 | orthology | 1 | 4 | - | - |
tritu_pan_p020078 | orthology | 1 | 4 | - | - |
tritu_pan_p022314 | orthology | 1 | 3 | - | - |
tritu_pan_p042574 | orthology | 1 | 3 | - | - |
tritu_pan_p051510 | orthology | 1 | 3 | - | - |