Gene cajca.ICPL87119.gnm1.ann1.C.cajan_43449.1


Sequence ID cajca.ICPL87119.gnm1.ann1.C.cajan_43449.1  add to my list
Species Cajanus cajan
Alias No gene alias
Length 249aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 249 amino acids

>cajca.ICPL87119.gnm1.ann1.C.cajan_43449.1_CAJCA
MAKEEKKKEIEVITAIYKVNLHCKECGNKIKRHLMITEGVQSVDIEFEKGEIKAKGKIDP
LKILKLIEKKSNKKVELISPKVKPKENTTTDTKPKEIKDPIIRIISLKVHMHCDKCEADL
KSRLIKHKGIFNVKTDQKAQSVTVEGTIEVEKLMSFLRKKGHKNSEIISIKEEKKGKEEG
KSSSESTKEKDHGESTKKKDDNKDKEVKSSGESTKEKKGDTKDNVPYIIHYVYAPQLFSD
ENPNSCSIL




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP342504 Unannotated cluster
4 GP464372 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_43449.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
FvH4_7g08060.1 orthology 0.95 4 - -
MELO3C006231.2.1 orthology 0.883 5 139.4 2.6e-33
Manes.06G027700.1 orthology 0.755 5 163.3 2.2e-40
cucsa_pan_p017527 orthology 0.881 5 179 8e-56
maldo_pan_p031662 orthology 0.68 3 189 9.08e-59
maldo_pan_p050157 orthology 0.946 4 - -
phavu.G19833.gnm2.ann1.Phvul.010G034132.1 orthology 0.133 1 323.2 1.5e-88
soybn_pan_p031851 orthology 0.151 2 300 5.68e-103
soybn_pan_p035421 orthology 0.217 2 - -