Gene capan_pan_p000343
| Sequence ID | capan_pan_p000343 add to my list |
|---|---|
| Species | Capsicum annuum |
| Alias | No gene alias |
| Pangenome status | Dispensable (2/3) |
| Length | 94aa |
Length: 94 amino acids
>capan_pan_p000343_CAPAN MNVELETRFIEKSHSRVIVCGNFVPQDVAIKIRKKTNRRVEILEIQDLSTVKDDEKQEQM PLVTSCDNHQGQGEAETYVTSQNPQPHTYFQVYR
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
Unrepresented genome(s):
CAPAN_Glabriusculum_Chiltepin_v2.0
CAPAN_CM334_v2.0
CAPAN_Zunla_1_v2.0
| 1. | 2. | 3. | |
|---|---|---|---|
| 1. CA.PGAv.1.6.scaffold438.131 | 0.00 | 148.02 | 148.02 |
| 2. Capang03g000612 | 148.02 | 0.00 | -0.00 |
| 3. Capang00g005366 | 148.02 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Bv5_110870_wcqq.t1 | orthology | 1 | 9 | - | - |
| Bv5_110870_wcqq.t2 | orthology | 1 | 9 | - | - |
| CgUng002450.1 | orthology | 1 | 8 | - | - |
| Cm118330.1 | orthology | 1 | 7 | - | - |
| Cs7g26570.1 | orthology | 1 | 8 | - | - |
| FvH4_5g12320.1 | orthology | 1 | 7 | - | - |
| Manes.05G138100.1 | orthology | 0.997 | 4 | 75.9 | 4.86e-19 |
| PGSC0003DMP400010112 | orthology | 0.168 | 2 | 140 | 2.48e-44 |
| Solyc03g119630.2.1 | orthology | 0.152 | 1 | 143 | 5.81e-46 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1 | orthology | 0.906 | 3 | - | - |
| cicar_pan_p024669 | orthology | 1 | 4 | - | - |
| cucsa_pan_p010693 | orthology | 1 | 9 | - | - |
| maldo_pan_p026714 | orthology | 1 | 7 | - | - |
| medtr_pan_p036900 | orthology | 1 | 4 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.004G158700.1 | orthology | 0.973 | 3 | - | - |
| soybn_pan_p040036 | orthology | 1 | 3 | - | - |
| soybn_pan_p040183 | orthology | 0.846 | 3 | - | - |
| soybn_pan_p040952 | orthology | 0.823 | 3 | - | - |
| soybn_pan_p042566 | orthology | 0.905 | 3 | - | - |
| thecc_pan_p001600 | orthology | 1 | 8 | - | - |
| vitvi_pan_p014384 | orthology | 1 | 7 | - | - |